PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00061.72
Common NameAMTR_s00061p00095620, LOC18447437
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 331aa    MW: 35720.1 Da    PI: 6.9516
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00061.72genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.4e-3446100155
                                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                              ++rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00061.72  46 RQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 100
                                              58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.01543103IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-3245101IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1845100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2547101IPR006447Myb domain, plants
PfamPF002491.4E-94899IPR001005SANT/Myb domain
PfamPF143791.4E-24132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MYHPKNISST TLVPTKPSSR DPQIDNAKMA ANSGGNPVNN SNMASRQRLR WTNELHERFV  60
DAVAQLGGPD RATPKGVLRV MGVQGLTIYH VKSHLQKYRL AKYLPESSSD GTKPDRKESA  120
DMLSNLDAAS GMQITEALRM QMEVQKRLHE QLEVQRQLQL RIEAQGKYLQ KIIEEQQRLS  180
GVLAGTPAIV PESGDHMPEP DAKTDPATPA VTSEAPLKDE PTKTKCLVAK SFSQEESFSS  240
RHEPPTPDSG SPGSSPCAER PVKKQRGLEP SGLGGLGHPI LESSSGSVFR QADMCSAYSS  300
LEGVSGRFDS LGSVSLCERE GFGDASGAEL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857596.10.0PREDICTED: uncharacterized protein LOC18447437
TrEMBLU5DF830.0U5DF83_AMBTC; Uncharacterized protein
STRINGVIT_00s0475g00040.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-89G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]